PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G107700.1.p
Common NameLOC101785488, SETIT_034822mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRF
Protein Properties Length: 591aa    MW: 61607.7 Da    PI: 7.0543
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G107700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.89.2e-24212255245
                 WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                          epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Seita.9G107700.1.p 212 LEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKHVEG 255
                         69***************************************986 PP

2QLQ59.59.9e-21144180137
                 QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                         ++FT++Q+ +L++Q+l+yKyLaan P+P+ Ll++i++
  Seita.9G107700.1.p 144 GPFTPSQWIELEHQALIYKYLAANIPIPHSLLVPIRR 180
                         59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009517.3E-12144180IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.2E-14145179IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.009145180IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.65211255IPR014977WRC domain
PfamPF088795.0E-20213254IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MELGGVVMDA GGGAAELGLL GGGSSRLLKH GRGNAAGEEH GWGGSGRAAK QARTTADVAE  60
AAKAAVAPFL LGSCSPGHGG EQMLSFSSAP ASSCASTAAV AAAAAAVAAD GAMPLYYGTP  120
ASCSGLSSVS LSSSMQGAMA RVRGPFTPSQ WIELEHQALI YKYLAANIPI PHSLLVPIRR  180
SLASSPYPPS YFGTSTLGWG SFQLGYSGNA DLEPGRCRRT DGKKWRCSRD AVADQKYCER  240
HMNRGRHRSR KHVEGQPGHA AKAMSAAVAA AAATQPAALA ASGAGATAAG LTVSQHQQPV  300
KSYAAGATDP CSLQYNRELV NKQNESDNMQ DSDNLSMLTS MSTRNPGSLF PFSKQNNPFE  360
VTSSRPEFGL VSSDSLMSSP HSSLENVNLL SSQSLNENQS SASLQHFVDW PRTPAQGGLS  420
WPDAEDMQAQ RSQLSVSAPM ASSELSSAST SPIHEKLMLS PLKLSREYSP IGLSIAASRD  480
EVSQLEANWA TMFRDSSMGG PLGEVLTKNG NAEAKNCLSA PLNLLTDFWD SSPGMESSPV  540
GVLQKTTFGS VSSSTGSSPR MENHGAYDGI SNLRDDLGSI VVSHPNIRLL *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981896.10.0PREDICTED: growth-regulating factor 6-like
SwissprotQ6AWY30.0GRF6_ORYSJ; Growth-regulating factor 6
TrEMBLK4A7G60.0K4A7G6_SETIT; Uncharacterized protein
STRINGSi034822m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42903568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.14e-49growth-regulating factor 2